view etc/xemacs.xpm @ 1204:e22b0213b713

[xemacs-hg @ 2003-01-12 11:07:58 by michaels] modules/ChangeLog: 2002-12-16 Ben Wing <ben@xemacs.org> * postgresql/postgresql.c: remove ifdef USE_KKCC. src/ChangeLog: 2003-01-08 Mike Sperber <mike@xemacs.org> * console.h (CDFW_CONSOLE): Don't lead to a crash if we're dealing with a dead window/frame/device/console. 2002-12-20 Mike Sperber <mike@xemacs.org> * ui-gtk.c: Fix typo from Ben's patch: emacs_ffi_data is a typedef, not a struct. emacs_gtk_object_data is a typedef, not a struct. * gtk-glue.c (gdk_event_to_emacs_event): Fix typos from Ben's patch: le -> emacs_event + rearrange the code. * event-gtk.c (gtk_event_to_emacs_event): Fix typos from Ben's patch: ..._UNDERLYING_GDK_EVENT -> ..._GDK_EVENT, ev -> key_event. * device-gtk.c: Fix typo from Ben's patch: x_keysym_map_hash_table -> x_keysym_map_hashtable. 2002-12-19 Mike Sperber <mike@xemacs.org> * menubar-x.c (set_frame_menubar): Initialize protect_me field of popup_data. 2002-12-16 Ben Wing <ben@xemacs.org> Major cleanup of KKCC, etc. KKCC, pdump-related: -- descriptions are written for all objects. this required some changes in the format of some objects, e.g. extents, popup-data, coding system, lstream, lcrecord-list. -- KKCC now handles weakness in markers, hash tables, elsewhere correctly (formerly, you'd eventually get a stack overflow due to endlessly expanding markers). -- textual changes: lrecord_description -> memory_description, struct_description -> sized_memory_description. -- extensive comment describing descriptions and pdump. -- redo XD_UNION so it works inline and change its format to provide sufficient info for pdump. implement XD_UNION in pdump. also add XD_UNION_DYNAMIC_SIZE, which works like XD_UNION except for when auto-computing structure sizes. -- add support for XD_INDIRECT in description offsets (used by extents). -- add support for "description maps", allowing for indirect descriptions that are retrieved from an object at run-time. this generalizes XD_CODING_SYSTEM_END, XD_SPECIFIER_END, etc., which have now been eliminated. -- add a fifth field "flags" to memory_description, to support flags that can be specified for this particular line. Currently defined flags are XD_FLAG_NO_KKCC (KKCC should ignore this entry; useful for the weakness above in markers, etc.), XD_FLAG_NO_PDUMP (pdump should ignore this entry), XD_FLAG_UNION_DEFAULT_ENTRY (in union maps, this specifies a "default" entry for all remaining values), and XD_FLAG_FREE_LISP_OBJECT (for use with lcrecord-lists). -- clean up the kkcc-itis in events, so that the differences between event data as separate objects and as a union are now minimized to a small number of places. with the new XD_UNION, we no longer need event data as separate objects, so this code is no longer ifdef USE_KKCC, but instead ifdef EVENT_DATA_AS_OBJECTS, not used by default. make sure that we explicitly free the separate event data objects when no longer in use, to maintain the invariant the event processing causes no consing. -- also remove other USE_KKCC ifdefs when not necessary. -- allow for KKCC compilation under MS Windows. -- fix README.kkcc. -- dump_add_root_object -> dump_add_root_lisp_object. -- implement dump_add_root_block and use this to handle dump_add_opaque. -- factor out some code duplicated in kkcc and pdump. Other allocation/object-related: -- change various *slots.h so MARKED_SLOT() call no longer includes semicolon. -- free_marker() takes a Lisp_Object not a direct pointer. -- make bit vectors lcrecords, like vectors, and eliminate code that essentially duplicated the lcrecord handling. -- additional asserts in FREE_FIXED_TYPE, formerly duplicated in the various callers of this. -- all lcrecord allocation functions now zero out the returned lcrecords. unnecessary calls to zero_lcrecord removed. add long comment describing these functions. -- extract out process and coding system slots, like for buffers, frames, etc. -- lcrecords now set the type of items sitting on the free list to lcrecord_type_free. -- changes to the way that gap arrays are allocated, for kkcc's benefit -- now, one single memory block with a stretchy array on the end, instead of a separate block holding the array. Error-checking-related: -- now can compile with C++ under MS Windows. clean up compile errors discovered that way. (a few were real problems) -- add C++ error-checking code to verify problems with mismatched GCPRO/UNGCPRO. (there were a few in the kkcc code.) add long comment about how to catch insufficient GCPRO (yes, it's possible using C++). -- add debug_p4(), a simple object printer, when debug_print() doesn't work. -- add dp() and db() as short synonyms of debug_print(), debug_backtrace(). -- `print' tries EXTREMELY hard to avoid core dumping when printing when crashing or from debug_print(), and tries as hard as it reasonably can in other situations. -- Correct the message output upon crashing to be more up-to-date. Event-related: -- document event-matches-key-specifier-p better. -- generalize the dispatch queues formerly duplicated in the various event implementations. add event methods to drain pending events. generalize and clean up QUIT handling, removing event-specific quit processing. allow arbitrary keystrokes, not just ASCII, to be the QUIT char. among other things, this should fix some longstanding bugs in X quit handling. long comment describing the various event queues. -- implement delaying of XFlush() if there are pending expose events. SOMEONE PLEASE TRY THIS OUT. -- Fix `xemacs -batch -l dunnet' under Cygwin. Try to fix under MS Windows but not quite there yet. Other: -- class -> class_ and no more C++ games with this item. new -> new_ in the lwlib code, so far not elsewhere. -- use `struct htentry' not `struct hentry' in elhash.c to avoid debugger confusion with hash.c. -- new macros ALIST_LOOP_3, ALIST_LOOP_4. * README.kkcc: * alloc.c: * alloc.c (deadbeef_memory): * alloc.c (allocate_lisp_storage): * alloc.c (copy_lisp_object): * alloc.c (ALLOCATE_FIXED_TYPE_1): * alloc.c (FREE_FIXED_TYPE): * alloc.c (make_vector_internal): * alloc.c (make_bit_vector_internal): * alloc.c (make_key_data): * alloc.c (make_button_data): * alloc.c (make_motion_data): * alloc.c (make_process_data): * alloc.c (make_timeout_data): * alloc.c (make_magic_data): * alloc.c (make_magic_eval_data): * alloc.c (make_eval_data): * alloc.c (make_misc_user_data): * alloc.c (struct string_chars_block): * alloc.c (mark_lcrecord_list): * alloc.c (make_lcrecord_list): * alloc.c (alloc_managed_lcrecord): * alloc.c (free_managed_lcrecord): * alloc.c (alloc_automanaged_lcrecord): * alloc.c (staticpro_1): * alloc.c (staticpro): * alloc.c (lispdesc_indirect_count_1): * alloc.c (lispdesc_indirect_description_1): * alloc.c (lispdesc_one_description_line_size): * alloc.c (lispdesc_structure_size): * alloc.c (mark_object_maybe_checking_free): * alloc.c (mark_with_description): * alloc.c (mark_struct_contents): * alloc.c (mark_object): * alloc.c (tick_lcrecord_stats): * alloc.c (free_cons): * alloc.c (free_key_data): * alloc.c (free_button_data): * alloc.c (free_motion_data): * alloc.c (free_process_data): * alloc.c (free_timeout_data): * alloc.c (free_magic_data): * alloc.c (free_magic_eval_data): * alloc.c (free_eval_data): * alloc.c (free_misc_user_data): * alloc.c (free_marker): * alloc.c (compact_string_chars): * alloc.c (gc_sweep): * alloc.c (garbage_collect_1): * alloc.c (Fgarbage_collect): * alloc.c (common_init_alloc_early): * alloc.c (init_alloc_early): * alloc.c (init_alloc_once_early): * buffer.c: * buffer.c (mark_buffer): * buffer.c (MARKED_SLOT): * buffer.c (cleanup_buffer_undo_lists): * buffer.c (Fget_file_buffer): * buffer.h (MARKED_SLOT): * bufslots.h: * bytecode.c: * callint.c: * casetab.c: * chartab.c: * chartab.c (symbol_to_char_table_type): * cmdloop.c: * cmdloop.c (Fcommand_loop_1): * config.h.in (new): * conslots.h: * console-gtk-impl.h (struct gtk_frame): * console-impl.h: * console-impl.h (struct console): * console-impl.h (MARKED_SLOT): * console-impl.h (CONSOLE_QUIT_EVENT): * console-msw-impl.h (XM_BUMPQUEUE): * console-msw.c (write_string_to_mswindows_debugging_output): * console-msw.h: * console-stream-impl.h: * console-stream-impl.h (struct stream_console): * console-stream.c: * console-stream.c (stream_init_console): * console-stream.h: * console-tty.c: * console-tty.h: * console-x.h: * console.c: * console.c (mark_console): * console.c (MARKED_SLOT): * console.c (allocate_console): * console.c (get_console_variant): * console.c (create_console): * console.c (delete_console_internal): * console.c (Fset_input_mode): * console.c (Fcurrent_input_mode): * console.c (common_init_complex_vars_of_console): * console.h: * console.h (console_variant): * console.h (device_metrics): * data.c: * data.c (Faref): * data.c (Faset): * data.c (decode_weak_list_type): * database.c: * debug.c (xemacs_debug_loop): * debug.c (FROB): * debug.c (Fadd_debug_class_to_check): * debug.c (Fdelete_debug_class_to_check): * debug.c (Fset_debug_classes_to_check): * debug.c (Fset_debug_class_types_to_check): * debug.c (Fdebug_types_being_checked): * debug.h (DASSERT): * device-gtk.c: * device-impl.h (struct device): * device-impl.h (MARKED_SLOT): * device-msw.c: * device-x.c: * device-x.c (x_init_device_class): * device-x.c (x_comp_visual_info): * device-x.c (x_try_best_visual_class): * device-x.c (x_init_device): * device-x.c (construct_name_list): * device-x.c (x_get_resource_prefix): * device-x.c (Fx_get_resource): * device-x.c (Fx_display_visual_class): * device.c: * device.c (MARKED_SLOT): * device.c (allocate_device): * device.c (Fmake_device): * device.c (delete_device_internal): * device.c (Fset_device_class): * device.h: * devslots.h: * devslots.h (MARKED_SLOT): * dialog-msw.c: * dired-msw.c (mswindows_ls_sort_fcn): * dired-msw.c (mswindows_get_files): * dired-msw.c (mswindows_format_file): * doprnt.c (parse_doprnt_spec): * dumper.c: * dumper.c (struct): * dumper.c (dump_add_root_block): * dumper.c (dump_add_root_struct_ptr): * dumper.c (dump_add_root_lisp_object): * dumper.c (pdump_struct_list_elt): * dumper.c (pdump_get_entry_list): * dumper.c (pdump_backtrace): * dumper.c (pdump_bump_depth): * dumper.c (pdump_register_sub): * dumper.c (pdump_register_object): * dumper.c (pdump_register_struct_contents): * dumper.c (pdump_register_struct): * dumper.c (pdump_store_new_pointer_offsets): * dumper.c (pdump_dump_data): * dumper.c (pdump_reloc_one): * dumper.c (pdump_allocate_offset): * dumper.c (pdump_scan_by_alignment): * dumper.c (pdump_dump_root_blocks): * dumper.c (pdump_dump_rtables): * dumper.c (pdump_dump_root_lisp_objects): * dumper.c (pdump): * dumper.c (pdump_load_finish): * dumper.c (pdump_file_get): * dumper.c (pdump_resource_get): * dumper.c (pdump_load): * editfns.c (save_excursion_restore): * editfns.c (user_login_name): * editfns.c (save_restriction_restore): * elhash.c: * elhash.c (htentry): * elhash.c (struct Lisp_Hash_Table): * elhash.c (HTENTRY_CLEAR_P): * elhash.c (LINEAR_PROBING_LOOP): * elhash.c (check_hash_table_invariants): * elhash.c (mark_hash_table): * elhash.c (hash_table_equal): * elhash.c (print_hash_table_data): * elhash.c (free_hentries): * elhash.c (make_general_lisp_hash_table): * elhash.c (decode_hash_table_weakness): * elhash.c (decode_hash_table_test): * elhash.c (Fcopy_hash_table): * elhash.c (resize_hash_table): * elhash.c (pdump_reorganize_hash_table): * elhash.c (find_htentry): * elhash.c (Fgethash): * elhash.c (Fputhash): * elhash.c (remhash_1): * elhash.c (Fremhash): * elhash.c (Fclrhash): * elhash.c (copy_compress_hentries): * elhash.c (elisp_maphash_unsafe): * elhash.c (finish_marking_weak_hash_tables): * elhash.c (prune_weak_hash_tables): * elhash.h: * emacs.c: * emacs.c (main_1): * emacs.c (main): * emacs.c (shut_down_emacs): * emodules.h (dump_add_root_lisp_object): * eval.c: * eval.c (unwind_to_catch): * eval.c (maybe_signal_error_1): * eval.c (maybe_signal_continuable_error_1): * eval.c (maybe_signal_error): * eval.c (maybe_signal_continuable_error): * eval.c (maybe_signal_error_2): * eval.c (maybe_signal_continuable_error_2): * eval.c (maybe_signal_ferror): * eval.c (maybe_signal_continuable_ferror): * eval.c (maybe_signal_ferror_with_frob): * eval.c (maybe_signal_continuable_ferror_with_frob): * eval.c (maybe_syntax_error): * eval.c (maybe_sferror): * eval.c (maybe_invalid_argument): * eval.c (maybe_invalid_constant): * eval.c (maybe_invalid_operation): * eval.c (maybe_invalid_change): * eval.c (maybe_invalid_state): * eval.c (Feval): * eval.c (call_trapping_problems): * eval.c (call_with_suspended_errors): * eval.c (warn_when_safe_lispobj): * eval.c (warn_when_safe): * eval.c (vars_of_eval): * event-Xt.c: * event-Xt.c (maybe_define_x_key_as_self_inserting_character): * event-Xt.c (x_to_emacs_keysym): * event-Xt.c (x_event_to_emacs_event): * event-Xt.c (emacs_Xt_enqueue_focus_event): * event-Xt.c (emacs_Xt_format_magic_event): * event-Xt.c (emacs_Xt_compare_magic_event): * event-Xt.c (emacs_Xt_hash_magic_event): * event-Xt.c (emacs_Xt_handle_magic_event): * event-Xt.c (Xt_timeout_to_emacs_event): * event-Xt.c (Xt_process_to_emacs_event): * event-Xt.c (signal_special_Xt_user_event): * event-Xt.c (emacs_Xt_next_event): * event-Xt.c (emacs_Xt_event_handler): * event-Xt.c (emacs_Xt_drain_queue): * event-Xt.c (emacs_Xt_event_pending_p): * event-Xt.c (check_if_pending_expose_event): * event-Xt.c (reinit_vars_of_event_Xt): * event-Xt.c (vars_of_event_Xt): * event-gtk.c: * event-gtk.c (IS_MODIFIER_KEY): * event-gtk.c (emacs_gtk_format_magic_event): * event-gtk.c (emacs_gtk_compare_magic_event): * event-gtk.c (emacs_gtk_hash_magic_event): * event-gtk.c (emacs_gtk_handle_magic_event): * event-gtk.c (gtk_to_emacs_keysym): * event-gtk.c (gtk_timeout_to_emacs_event): * event-gtk.c (gtk_process_to_emacs_event): * event-gtk.c (dragndrop_data_received): * event-gtk.c (signal_special_gtk_user_event): * event-gtk.c (emacs_gtk_next_event): * event-gtk.c (gtk_event_to_emacs_event): * event-gtk.c (generic_event_handler): * event-gtk.c (emacs_shell_event_handler): * event-gtk.c (emacs_gtk_drain_queue): * event-gtk.c (emacs_gtk_event_pending_p): * event-gtk.c (reinit_vars_of_event_gtk): * event-gtk.c (vars_of_event_gtk): * event-msw.c: * event-msw.c (struct winsock_stream): * event-msw.c (winsock_reader): * event-msw.c (winsock_writer): * event-msw.c (mswindows_enqueue_dispatch_event): * event-msw.c (mswindows_enqueue_misc_user_event): * event-msw.c (mswindows_enqueue_magic_event): * event-msw.c (mswindows_enqueue_process_event): * event-msw.c (mswindows_enqueue_mouse_button_event): * event-msw.c (mswindows_enqueue_keypress_event): * event-msw.c (mswindows_dequeue_dispatch_event): * event-msw.c (emacs_mswindows_drain_queue): * event-msw.c (mswindows_need_event_in_modal_loop): * event-msw.c (mswindows_need_event): * event-msw.c (mswindows_wm_timer_callback): * event-msw.c (dde_eval_string): * event-msw.c (Fdde_alloc_advise_item): * event-msw.c (mswindows_dde_callback): * event-msw.c (mswindows_wnd_proc): * event-msw.c (remove_timeout_mapper): * event-msw.c (emacs_mswindows_remove_timeout): * event-msw.c (emacs_mswindows_event_pending_p): * event-msw.c (emacs_mswindows_format_magic_event): * event-msw.c (emacs_mswindows_compare_magic_event): * event-msw.c (emacs_mswindows_hash_magic_event): * event-msw.c (emacs_mswindows_handle_magic_event): * event-msw.c (emacs_mswindows_select_console): * event-msw.c (emacs_mswindows_unselect_console): * event-msw.c (reinit_vars_of_event_mswindows): * event-msw.c (vars_of_event_mswindows): * event-stream.c: * event-stream.c (mark_command_builder): * event-stream.c (reset_command_builder_event_chain): * event-stream.c (allocate_command_builder): * event-stream.c (copy_command_builder): * event-stream.c (command_builder_append_event): * event-stream.c (event_stream_event_pending_p): * event-stream.c (event_stream_force_event_pending): * event-stream.c (maybe_read_quit_event): * event-stream.c (event_stream_drain_queue): * event-stream.c (remove_quit_p_event): * event-stream.c (event_stream_quit_p): * event-stream.c (echo_key_event): * event-stream.c (maybe_kbd_translate): * event-stream.c (execute_help_form): * event-stream.c (event_stream_generate_wakeup): * event-stream.c (enqueue_dispatch_event): * event-stream.c (enqueue_magic_eval_event): * event-stream.c (Fenqueue_eval_event): * event-stream.c (enqueue_misc_user_event): * event-stream.c (enqueue_misc_user_event_pos): * event-stream.c (next_event_internal): * event-stream.c (Fnext_event): * event-stream.c (Faccept_process_output): * event-stream.c (execute_internal_event): * event-stream.c (munge_keymap_translate): * event-stream.c (command_builder_find_leaf_no_mule_processing): * event-stream.c (command_builder_find_leaf): * event-stream.c (lookup_command_event): * event-stream.c (is_scrollbar_event): * event-stream.c (execute_command_event): * event-stream.c (Fdispatch_event): * event-stream.c (Fread_key_sequence): * event-stream.c (dribble_out_event): * event-stream.c (vars_of_event_stream): * event-tty.c (tty_timeout_to_emacs_event): * event-tty.c (emacs_tty_next_event): * event-tty.c (emacs_tty_drain_queue): * event-tty.c (reinit_vars_of_event_tty): * event-unixoid.c: * event-unixoid.c (find_tty_or_stream_console_from_fd): * event-unixoid.c (read_event_from_tty_or_stream_desc): * event-unixoid.c (drain_tty_devices): * event-unixoid.c (poll_fds_for_input): * events.c: * events.c (deinitialize_event): * events.c (zero_event): * events.c (mark_event): * events.c (print_event_1): * events.c (print_event): * events.c (event_equal): * events.c (event_hash): * events.c (Fmake_event): * events.c (Fdeallocate_event): * events.c (Fcopy_event): * events.c (map_event_chain_remove): * events.c (character_to_event): * events.c (event_to_character): * events.c (Fevent_to_character): * events.c (format_event_object): * events.c (upshift_event): * events.c (downshift_event): * events.c (event_upshifted_p): * events.c (Fevent_live_p): * events.c (Fevent_type): * events.c (Fevent_timestamp): * events.c (CHECK_EVENT_TYPE): * events.c (CHECK_EVENT_TYPE2): * events.c (CHECK_EVENT_TYPE3): * events.c (Fevent_key): * events.c (Fevent_button): * events.c (Fevent_modifier_bits): * events.c (event_x_y_pixel_internal): * events.c (event_pixel_translation): * events.c (Fevent_process): * events.c (Fevent_function): * events.c (Fevent_object): * events.c (Fevent_properties): * events.c (syms_of_events): * events.c (vars_of_events): * events.h: * events.h (struct event_stream): * events.h (struct Lisp_Key_Data): * events.h (KEY_DATA_KEYSYM): * events.h (EVENT_KEY_KEYSYM): * events.h (struct Lisp_Button_Data): * events.h (EVENT_BUTTON_BUTTON): * events.h (struct Lisp_Motion_Data): * events.h (EVENT_MOTION_X): * events.h (struct Lisp_Process_Data): * events.h (EVENT_PROCESS_PROCESS): * events.h (struct Lisp_Timeout_Data): * events.h (EVENT_TIMEOUT_INTERVAL_ID): * events.h (struct Lisp_Eval_Data): * events.h (EVENT_EVAL_FUNCTION): * events.h (struct Lisp_Misc_User_Data): * events.h (EVENT_MISC_USER_FUNCTION): * events.h (struct Lisp_Magic_Eval_Data): * events.h (EVENT_MAGIC_EVAL_INTERNAL_FUNCTION): * events.h (struct Lisp_Magic_Data): * events.h (EVENT_MAGIC_UNDERLYING): * events.h (EVENT_MAGIC_GDK_EVENT): * events.h (struct Lisp_Event): * events.h (XEVENT_CHANNEL): * events.h (SET_EVENT_TIMESTAMP_ZERO): * events.h (SET_EVENT_CHANNEL): * events.h (SET_EVENT_NEXT): * events.h (XSET_EVENT_TYPE): * events.h (struct command_builder): * extents.c: * extents.c (gap_array_adjust_markers): * extents.c (gap_array_recompute_derived_values): * extents.c (gap_array_move_gap): * extents.c (gap_array_make_gap): * extents.c (gap_array_insert_els): * extents.c (gap_array_delete_els): * extents.c (gap_array_make_marker): * extents.c (gap_array_delete_marker): * extents.c (gap_array_move_marker): * extents.c (make_gap_array): * extents.c (free_gap_array): * extents.c (extent_list_num_els): * extents.c (extent_list_insert): * extents.c (mark_extent_auxiliary): * extents.c (allocate_extent_auxiliary): * extents.c (decode_extent_at_flag): * extents.c (verify_extent_mapper): * extents.c (symbol_to_glyph_layout): * extents.c (syms_of_extents): * faces.c: * file-coding.c: * file-coding.c (struct_detector_category_description =): * file-coding.c (detector_category_dynarr_description_1): * file-coding.c (struct_detector_description =): * file-coding.c (detector_dynarr_description_1): * file-coding.c (MARKED_SLOT): * file-coding.c (mark_coding_system): * file-coding.c (coding_system_extra_description_map): * file-coding.c (coding_system_description): * file-coding.c (allocate_coding_system): * file-coding.c (symbol_to_eol_type): * file-coding.c (Fcoding_system_aliasee): * file-coding.c (set_coding_stream_coding_system): * file-coding.c (struct convert_eol_coding_system): * file-coding.c (struct undecided_coding_system): * file-coding.c (undecided_mark_coding_stream): * file-coding.c (coding_category_symbol_to_id): * file-coding.c (struct gzip_coding_system): * file-coding.c (coding_system_type_create): * file-coding.h: * file-coding.h (struct Lisp_Coding_System): * file-coding.h (CODING_SYSTEM_SLOT_DECLARATION): * file-coding.h (coding_system_variant): * file-coding.h (struct coding_system_methods): * file-coding.h (DEFINE_CODING_SYSTEM_TYPE_WITH_DATA): * file-coding.h (INITIALIZE_CODING_SYSTEM_TYPE_WITH_DATA): * file-coding.h (struct coding_stream): * fileio.c (Fsubstitute_in_file_name): * floatfns.c: * fns.c: * fns.c (base64_encode_1): * frame-gtk.c: * frame-gtk.c (Fgtk_start_drag_internal): * frame-impl.h (struct frame): * frame-impl.h (MARKED_SLOT): * frame-msw.c: * frame-x.c: * frame-x.c (Fcde_start_drag_internal): * frame-x.c (Foffix_start_drag_internal): * frame.c: * frame.c (MARKED_SLOT): * frame.c (allocate_frame_core): * frame.c (delete_frame_internal): * frame.c (Fmouse_position_as_motion_event): * frameslots.h: * frameslots.h (MARKED_SLOT_ARRAY): * free-hook.c: * glyphs-msw.c (mswindows_widget_instantiate): * glyphs-x.c: * glyphs-x.c (convert_EImage_to_XImage): * glyphs.c: * glyphs.c (process_image_string_instantiator): * glyphs.c (mark_image_instance): * glyphs.c (allocate_image_instance): * glyphs.c (unmap_subwindow): * glyphs.c (map_subwindow): * glyphs.c (syms_of_glyphs): * glyphs.c (specifier_type_create_image): * glyphs.h: * glyphs.h (struct text_image_instance): * glyphs.h (struct Lisp_Image_Instance): * gmalloc.c: * gmalloc.c ("C"): * gpmevent.c (Freceive_gpm_event): * gpmevent.c (gpm_next_event_cb): * gpmevent.c (vars_of_gpmevent): * gtk-glue.c (gdk_event_to_emacs_event): * gtk-xemacs.c (gtk_xemacs_class_init): * gui-msw.c: * gui-msw.c (mswindows_handle_gui_wm_command): * gui-msw.c (mswindows_translate_menu_or_dialog_item): * gui-x.c: * gui-x.c (mark_popup_data): * gui-x.c (snarf_widget_value_mapper): * gui-x.c (gcpro_popup_callbacks): * gui-x.c (ungcpro_popup_callbacks): * gui-x.c (free_popup_widget_value_tree): * gui-x.c (popup_selection_callback): * gui-x.h: * gui-x.h (struct popup_data): * gui.c: * gui.c (allocate_gui_item): * gutter.c (decode_gutter_position): * hash.c (NULL_ENTRY): * indent.c (vmotion_1): * indent.c (vmotion_pixels): * input-method-motif.c (res): * input-method-xlib.c (IMInstantiateCallback): * input-method-xlib.c (XIM_init_device): * input-method-xlib.c (res): * intl-encap-win32.c: * intl-encap-win32.c (qxeSHGetDataFromIDList): * intl-win32.c: * intl-win32.c (mswindows_multibyte_cp_type): * intl-win32.c (struct mswindows_multibyte_coding_system): * keymap.c: * keymap.c (make_key_description): * keymap.c (keymap_store): * keymap.c (get_keyelt): * keymap.c (keymap_lookup_1): * keymap.c (define_key_parser): * keymap.c (key_desc_list_to_event): * keymap.c (event_matches_key_specifier_p): * keymap.c (meta_prefix_char_p): * keymap.c (ensure_meta_prefix_char_keymapp): * keymap.c (Fdefine_key): * keymap.c (struct raw_lookup_key_mapper_closure): * keymap.c (raw_lookup_key): * keymap.c (raw_lookup_key_mapper): * keymap.c (lookup_keys): * keymap.c (lookup_events): * keymap.c (Flookup_key): * keymap.c (struct map_keymap_unsorted_closure): * keymap.c (map_keymap_unsorted_mapper): * keymap.c (map_keymap_sorted): * keymap.c (map_keymap_mapper): * keymap.c (map_keymap): * keymap.c (accessible_keymaps_mapper_1): * keymap.c (Faccessible_keymaps): * keymap.c (Fsingle_key_description): * keymap.c (raw_keys_to_keys): * keymap.c (format_raw_keys): * keymap.c (where_is_recursive_mapper): * keymap.c (where_is_internal): * keymap.c (describe_map_mapper_shadow_search): * keymap.c (keymap_lookup_inherited_mapper): * keymap.c (describe_map_mapper): * keymap.h (event_matches_key_specifier_p): * lisp.h: * lisp.h (this): * lisp.h (RETURN_NOT_REACHED): * lisp.h (struct Lisp_Vector): * lisp.h (struct Lisp_Bit_Vector): * lisp.h (UNGCPRO_1): * lisp.h (NUNGCPRO): * lisp.h (NNUNGCPRO): * lisp.h (DECLARE_INLINE_HEADER): * lrecord.h: * lrecord.h (struct lrecord_header): * lrecord.h (struct lcrecord_header): * lrecord.h (lrecord_type): * lrecord.h (struct lrecord_implementation): * lrecord.h (RECORD_DUMPABLE): * lrecord.h (memory_description_type): * lrecord.h (data_description_entry_flags): * lrecord.h (struct memory_description): * lrecord.h (struct sized_memory_description): * lrecord.h (XD_INDIRECT): * lrecord.h (XD_IS_INDIRECT): * lrecord.h (XD_DYNARR_DESC): * lrecord.h (DEFINE_BASIC_LRECORD_IMPLEMENTATION): * lrecord.h (MAKE_LRECORD_IMPLEMENTATION): * lrecord.h (MAKE_EXTERNAL_LRECORD_IMPLEMENTATION): * lrecord.h (alloc_lcrecord_type): * lstream.c: * lstream.c (Lstream_new): * lstream.c (lisp_buffer_marker): * lstream.h: * lstream.h (lstream_implementation): * lstream.h (DEFINE_LSTREAM_IMPLEMENTATION): * lstream.h (DEFINE_LSTREAM_IMPLEMENTATION_WITH_DATA): * marker.c: * marker.c (copy_marker_1): * mem-limits.h: * menubar-gtk.c: * menubar-gtk.c (gtk_popup_menu): * menubar-msw.c: * menubar-msw.c (mswindows_popup_menu): * menubar-x.c (make_dummy_xbutton_event): * menubar-x.c (command_builder_operate_menu_accelerator): * menubar-x.c (menu_accelerator_safe_compare): * menubar-x.c (menu_accelerator_safe_mod_compare): * mule-charset.c: * mule-charset.c (make_charset): * mule-charset.c (Fcharset_property): * mule-coding.c: * mule-coding.c (ccs_description_1): * mule-coding.c (ccs_description =): * mule-coding.c (ccsd_description_1): * mule-coding.c (ccsd_description =): * nt.c (getpwnam): * nt.c (init_mswindows_environment): * nt.c (get_cached_volume_information): * nt.c (mswindows_is_executable): * nt.c (read_unc_volume): * nt.c (mswindows_access): * nt.c (mswindows_link): * nt.c (mswindows_fstat): * nt.c (mswindows_stat): * nt.c (mswindows_executable_type): * nt.c (Fmswindows_short_file_name): * nt.c (Fmswindows_long_file_name): * objects-impl.h (struct Lisp_Color_Instance): * objects-impl.h (struct Lisp_Font_Instance): * objects-tty.c: * objects-x.c (allocate_nearest_color): * objects.c: * objects.c (Fmake_color_instance): * objects.c (Fmake_font_instance): * objects.c (font_instantiate): * opaque.c: * opaque.c (make_opaque): * opaque.c (make_opaque_ptr): * opaque.c (reinit_opaque_early): * opaque.c (init_opaque_once_early): * print.c: * print.c (printing_badness): * print.c (printing_major_badness): * print.c (print_internal): * print.c (debug_p4): * print.c (dp): * print.c (debug_backtrace): * process-nt.c (nt_create_process): * process-nt.c (get_internet_address): * process-unix.c: * process-unix.c (struct unix_process_data): * process-unix.c (get_internet_address): * process-unix.c (unix_alloc_process_data): * process-unix.c (unix_create_process): * process-unix.c (try_to_initialize_subtty): * process-unix.c (unix_kill_child_process): * process-unix.c (process_type_create_unix): * process.c: * process.c (mark_process): * process.c (MARKED_SLOT): * process.c (make_process_internal): * process.c (Fprocess_tty_name): * process.c (decode_signal): * process.h: * procimpl.h: * procimpl.h (struct process_methods): * procimpl.h (struct Lisp_Process): * rangetab.c: * realpath.c (readlink_and_correct_case): * redisplay-x.c (x_window_output_end): * redisplay-x.c (x_redraw_exposed_area): * redisplay-x.c (x_clear_frame): * redisplay.c: * redisplay.h: * redisplay.h (struct rune_dglyph): * redisplay.h (struct rune): * scrollbar.c: * scrollbar.c (create_scrollbar_instance): * specifier.c: * specifier.c (specifier_empty_extra_description_1): * specifier.c (make_specifier_internal): * specifier.c (decode_locale_type): * specifier.c (decode_how_to_add_specification): * specifier.h: * specifier.h (struct specifier_methods): * specifier.h (DEFINE_SPECIFIER_TYPE_WITH_DATA): * specifier.h (INITIALIZE_SPECIFIER_TYPE_WITH_DATA): * symbols.c: * symbols.c (Fsetplist): * symbols.c (default_value): * symbols.c (decode_magic_handler_type): * symbols.c (handler_type_from_function_symbol): * symbols.c (Fdefvaralias): * symbols.c (init_symbols_once_early): * symbols.c (reinit_symbols_early): * symsinit.h: * sysdep.c (sys_subshell): * sysdep.c (tty_init_sys_modes_on_device): * syswindows.h: * text.c (dfc_convert_to_external_format): * text.c (dfc_convert_to_internal_format): * text.c (reinit_eistring_early): * text.c (init_eistring_once_early): * text.c (reinit_vars_of_text): * text.h: * text.h (INC_IBYTEPTR_FMT): * text.h (DEC_IBYTEPTR_FMT): * toolbar.c: * toolbar.c (decode_toolbar_position): * tooltalk.c: * ui-gtk.c: * unexnt.c: * unexnt.c (_start): * unexnt.c (unexec): * unexnt.c (get_section_info): * unicode.c: * unicode.c (vars_of_unicode): * window.c: * window.c (allocate_window): * window.c (new_window_mirror): * window.c (update_mirror_internal): * winslots.h:
author michaels
date Sun, 12 Jan 2003 11:08:22 +0000
parents 3ecd8885ac67
children 7910031dd78a
line wrap: on
line source

/* XPM */
static char *noname[] = {
/* width height ncolors chars_per_pixel */
"388 145 25 1",
/* colors */
"` c #787879",
"a c #686869",
"b c #A6AAF5",
"c c #585859",
"d c #484849",
"e c #09090B",
"f c #5256D7",
"g c #989CEA",
"h c #363ACC",
"i c #C7C8CF",
"j c #282829",
"k s None c None",
"l c #13154C",
"m c #7074DF",
"n c #D9D9DB",
"o c #232788",
"p c #383838",
"q c #4249D0",
"r c #B6BAF9",
"s c #868AEB",
"t c #A8A8A9",
"u c #989899",
"v c #6266DB",
"w c #888889",
"x c #B9B9B9",
/* pixels */
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkknkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknikkkknninkkkkkkkkkkknninnnkkkkkkkkkinkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkknknkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkxkkkkkkknkkkkkkknkkkknknkkkkkkknkkkkknknnkkkkkkkkknkkknkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkknnkknnnnikkkkkkkkkknnnnkkknnnnnkkkinnikkkkkinnkkkkkkkkkkikkkkkkknkkkkkkknnkkkkkkkkkkkinnnnkkknnnkkkkkkkkkknnninnkknnnnnkkknnninkkinnnnkkkkkkkkkkinnnkkknnnnnkknnnnnkkknkxnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkknkkknkkniiiinkknkkknkknkkknkknkkkknkknxkkkkkkkkkkkkkkkkkkkkknkkkkkkiinnkkkknkkkknnnnnxkkkkxkkkkniiiinknnknknkknkkkkkknkkkknknnnnnikkiiiiikkknkknkknkkkknkknkkkknkknikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkknkkkkkkkkkknkkknkknkkkknknkkkknkknnikkkkkkkkkkkkkkkkkkkknkknkkikkknkkkknkkkknnnknnkkkxkikkkkkkkkkknnknknkknkkkknknkkkknkinnnnnkkkkkkkkkknkknkknkkkknkknkkkknkkinnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkknnkknkkkxkkkkkkkkkknkkknkkinkkikknnkknnkknkkikkkkkkkkkkkkkkkkkkknkknkkikknnkkkknkkkkkxkkkkkkikkkikkkkkkkkknnknknkknnknxkknnkkinkkxkkkkkkkkkkkkkknkknkkkikknikkinkkikkknknnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkknkknkkninnikkkkkkkknxkkixkkkixxnkkknxxnkkiikkxxkkkkkkkkkkkkkkkknxxxxxkknxxkxnkkixxnkkkkxxikknxiknxnkkkkkkknxikxknnkkixikkkknxikxnkkixikkkkkkkkkkixkkxxkkkixnkkkkixxkkkxnknxikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkknkkkkkkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkknkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknknkkkkknkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknkkkkkknkknkkkkkkkkkkkkkknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkkknkkkkkkknknknkkkkknkknkknkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkknkkknkknkkkkkkkknknknkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkknkknknknkknkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkknuunnkknkkkknkkknkkkkntkkkkkkkkkkiikkkkkkknkkkkkknkkkknnkkkknnkkknkkkkkkkkkkkkkkkknkknkknkkknknkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkknknkkkknkkkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkknkkkknkkkkkkkkkkkknkkkkkkkkkknktnkkkkiknkkkknkkkkkkkkkkkkikkkkkkkkkkkinkkknkkkkknkkkknknkkukkkktkknkknkkkkkkknknkknkkkknknknknkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkknknkkknknknkkkkkknknknkknkkkknkknknkknkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkknknkkkkkknknkkkkkkkknkknkkknkkkkkknkkkkkkkkktkkkknikkknnkixnknininnnkkxkninkkkkiikikknniikkkkknkkkkkkkxnknkkiikkknknkkkkkkknkkkknkknkkkkkknknknkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkkkknkkkkknkkkkkkkknkkknkknknkkkkknkknkkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkknkknnknkkknnkkkkkkknkkkkkkkkknkkknkkkkkkknnknkkkxnkkkknixtkkxuxuxxikitxiukkktiiuxkknixxikkkkknkkknkktkkkkkktkkkkkkkkkkknkkknknkkkknknknkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkknkkkkknkknkknknnkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkknknkknkkknkkknknkknknkkkxkkkkkkxknknkiuuukknukxkkxkxnkkktkikkkkxkkktutikknkkknknkkkxknknkkxnknkknknkkkkknkkkknknkkkkknkkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkknkknkknkkknknknknkkkkkkknkkkkkknnkkkkkkkknkkknkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkknkkkkkkkkknknkkkkkxkkkknkxknkkntnktnkkwkxkkxkxkkkkxkxkkkkxkkxnknxkkkkkkkkknkkxnkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkknkkknkkkkknkknkkkknkkkkkkkkkknkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknnknnkxknkknxkknkxkkkwknkwkxkkxkxunkxnkntkkttkktkkixkkkknkkkknkktkknknnxkknkknknknkkkkkknkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkknkknkknknkkknkkkkkkkkknkknkkkkkkknkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkunkkxwwwwikkuwunwkwwktikwnwnwwnkkknwwittkiwwnwnnkkkknkkkkkntkkkktnnkknkkkknknknnnnnnnnnnnnnkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkknknkkkkkknkkkkkkkkkkkknkknknnnknknkkknknknknnkkknknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkrrrrrrrrrbrrrrrrbrrrrrrrrrrrrrikinnkkknirrrrrrrrbrbrbrrbrrriknkkkkkkrrrrrrrrrrrrrrbrrrbrbrrrrbrrrrrrrrrrrrrrrrrrssssssgsggbkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkknkknknknknknkkknknkkkknknkknkknknkknkknknkkkkkkkkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkrhhhqhhhhhhhhhhhhhhhhhhhhhhhhhhmkkknkkkivhhhhhhhhhhhhhhhhhhhmknknkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhtnknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkknkkkknknkkkknkknkkkkkkkkkkkkkknkkknknnkknknkkknkknknkkkkkkkkkkknknnkknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkkknkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkknknknkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodknkkkknvhhhhhhhhhhhhhhhhhhhockkkkkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoenkkknnkkkkknkknknkknkknknnknkkkkkkkkkknkknkknkkkkknknkkkkkknkknknkkkkkkkkkkkkknnkknknknnkknknknkkkknkknknkkkkknkknnnkknnkkknkknknkkknnkkkkknkknkkknknkknnnkkkkkkkkkkkknkknkknkkkkknknkkkkkknkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkmohhhhhhhhhhhhhhhhhhhhhhhhhoooldkknknkkbhohhhhhhhhhhhhhhhholdnknnkkkmohhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlcnknknkkkkknkkkkkkknknknknkkkkkkknkknnkkkknkkkknnkkkkkkknknkknkkkkknknnkkkkknkkknnkkkkkknknkknknknknknknknknknkknkkknkkkknnkknknknknknkkkkknkkkkknknkknkkknknkkkknkknnkkkknkkkknnkkkkkkknknknnknkkknknnkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkdpllhhhhhhhhhhhhhhhhhhholeepddwnkknknkkwdddqhhhhhhhhhhooeepwknkkknkkddjeoqhhhhhhhhhhhhhhhhhhleeeeeeelloohhhhhhhhhhhhhhhhl`nnnnknknknknnknknkknkkkkkknkknkkkkkkknknkkkkkkknnnknknkkknnkkknnnkkkkkkknkkkknkkknkkkkkkkknknkkknkkkknkkknkkknknkknnknkkkkkkkknknknkkknknknknknkkkknkkkkkkkkknkkkkkkknknkkkkkkknnnknknkkknkkkknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkx`fhhhhhhhhhhhhhhhhledtnnknnnnnnnnnkkkknshhhhhhhhhlej`nnnnniknknkkkkknghhhhhhhhhhhhhhhhoel`xnninitwudplohhhhhhhhhhhhheunnnnnnnknknkknkknnnkkknknkkkkkkkkkknkknkknnnkkkkkkkkkkkkkkkknkkkknnknkkkkkkkkkkkkknkkknkkkkkknnkkkknkkknknnnkkkkkkkkknkkknknkkkkkkknkkknknknknknnnnknknnknkkkkkkkkknkknkknnnkkkkkkkkkkkkknknkkknknnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnmhhhhhhhhhhhhhhhlcxxiixixxxxiinnnkkkighhhhhhhheeaxxxxxxxiiinnknkknnivhhhhhhhhhhhhhhhejxxixxxxxxxxxii`dohhhhhhhhhhoetxtxxinnnnknknknknknnnknkknknkkkknkkkknknnkkkkkkkknkkknkknknknknknkknknknnkkkkknkkkknkkknnknknkkknkkkknknkkknknknknkkkknkkkkkknknkkkkkkkkknknknkknknnknkkknknkkknkkkkknknnkkkkkkkknkkknkknkknknkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkknirfhhhhhhhhhhhhhhecuuwwuuuuuuutxnnnkkrvhhhhhhoeewuwwwuuuuutxxnnknkknrvhhhhhhhhhhhhhhoewwuwuuuwuuwuwuuuuwdqhhhhhhhhoew`wwwuxnnnkknkkknknknknknkkkkknnkknkkkknknnknnknkkkkknkkkkkkkknknkkkkkkkkknknkkkknkkkkkkknkknkknkkknknkkknnknnnkknkkkknknkkknkkkkknkkkkknkkkknkkknkknnknnkkkkknkknknkkknknnknnknkkkkknkkkkkkkkknnnkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknitshhhhhhhhhhhhhhlcccccaaaa``wuxinnkrbhhhhhhoejdccaacacaaa`utxnnkknnrvhhhhhhhhhhhhhhllccaccaaaaaaaaaaaaaaaqhhhhhhhljcdcca`txnkkkkkkknknkkkkkknnnknkknnnknkkkkkkkknkkknnkkknkknknkkkkkknkknnkkkknkknkkkkkkkkkkknkknknnknkknknkknkknknknknkknknkkkknknkkkkkkkkkkkkkkknknnkkkkkknnnknkknnnkkkkkkkkkknkkknnkkknkknknknkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkniughhhhhhhhhhhhhhljjpjpppdcaa`utxnnirfhhhhhoeejjpjpjpppddcaaccxnkkinrhhhhhhhhhhhhhhhejjpjppppjpccaccccccddvqhhhhhheejjjjpawxinkkkknkkknknnnnnkknknknkknknnkknkknknknnkknkkkkknkknknkkkkkkuukknkkkkknkkkkkkkknkkknnkkkknkkknknknknkknknknkkkkknkkkkkknknnkkkkknkkkknkkkknknnnkknknknnknknnnkknkknknknnkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnituvhhhhhhhhhhhhhoeeejejpdca`wuxinnrmhhhhhoelpjejejejjjdda`ctnkkkkxnrhhhhhhhhhhhhhhoeeeeejejpdpcaaa`aaaccddmhhhhhheeeeejpc`cdannknknkknknxa`cackknknnnnkccnkcaknkkknknkkkknkkknknkkkkkkkkktkkkkkkkkknkkkkkkkkkknkkkknkknkkkkkknknknknkkkknknknkknkkkkkkkkkkkkkknknknknknknknkkkknknknnknknnkkkknkkknknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkniitshhhhhhhhhhhhhheeeejjpc`wutxinnrshhhhhoejcdpeeeeeejpc`aaautnnkttishhhhhhhhhhhhhhleeeeeeljpccwaa`uwwacaacsqhhhhoeeeeeejcwxunknkkkittkkktkntktnknxtinknndknwnkkkknknktitniikkkntxkkkkkxxkxkkkitxkkkknknkknxxxkxnnnkitxknntkttnknknknknnkkknkknkkknknkkkkkkknknkkkkknkkknknknnkknknnknknnknknnkkknkknnkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnirhhhhhhhhhhhhhheeeeepc`utxxinnighhhhhoepcapjeeeeejjp`wwwatxkknt`rmhhhhhhhhhhhhhhleeeeeejpc`ata`uxxca`ccwwmhhhhleeeeejpawxunkknkktttwnnkkktkkkn`uuu`nknn`cknnnkkkkkkt`xaxuikn`xx`nkk`ttaukk`uxw`nkkkkkkknwuu`xwknntxuiki``ut`xkknkknknnnknkkkkknkkkkkkkknkkkknnkknkknnkkkkkknknnknnnnknknnknnkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknnknivhhhhhhhhhhhhhleeejpauxinnnnrbqhhhhoedwiwapjeeejjdjtxinunnnkkktrfhhhhhhhhhhhhhheeeeeeeejwuwctnnni`uuwcutshhhheeeeeejpauxuknnknkua`uknnkktnknn`ttuaxknn`wknkxaaacakkckxkkxkxkkkktktnkkkwki`ttxaxnwaaa`tkttntktkkn`autkktnknkwkknknkkkkkkknknkknkkkkkkkknnnknkknkknknknnkknkknkknknknnnnknknnkkknnkkknkkkkkkkkkkkkkknkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknkknknknshhhhhhhhhhhhhoeeejd`uinnkkrrqhhhhhednuxucpejejpda`xinntnkknnkxrhhhhhhhhhhhhhhoeeeeeejpaux`x`nnnx`ttuuiighhhheleeeejp`tiunkntktxnnwkknkntknkx`ttttnnkwxttkkkkkkkkknaktkktktkkkktktknnktkx`ttttnkknkkkkkxxkuntnkunkntkkunknkwnkkknkknknnknknknknkknnknkkknknnnknknnkknknknknknnnknkkkknkkkkkknkkkkknkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkknknknknkbhhhhhhhhhhhhhheeejd`tinknrbqhhhhoejnnu`wdjejjjauxxnnnkuknkknnbshhhhhhhhhhhhhhleeeeeejc`titni`knkcxkniknrhhhoepjeeejd`titnknukwkkn`nknkktkknncxkknkktxnkcnknkkknkkkaktkktkitkkuxkn`knw`nkaxnnnnkkkkkkkktxntntnnukktxkkx`nkuinnnknknknkkkknnkkkknnkkknnknknkknkkkkkknknkkkkknknkkkkkkkknnknkkkkkkkkkkkkkkkkkkkknkknkkknnkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknnknknkkknnnfhhhhhhhhhhhhhleejd`tnkkibqhhhhheeinnxajjjepdadd`xknwcccwkntarmhhhhhhhhhhhhhheeeeeeepcwx`unkcanknwcwxknrhhhoecpeeepcwwccccaxkicctuwkntcccnnknwa`xkkaakkackkknkknnaakuikakkiacxknknacxwwnnua`xnknkkkkkiawkanxwkuccicxktn`ciknkknknknknknkkkkknkknnnknnknnnnnkknnnkknknknknnnknnknknkkkkkkkkknknknnkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknnknkknmhhhhhhhhhhhhhoeejpauxnirfhhhhoeltxnit`cpjpd`utnnkknnnknknkknrqhhhhhhhhhhhhhoeeeeeejpauxknkknnknknknnkkrhhhld`djjjpcwxnnknknnknknknkknkkknkknnnnnkknknkkkknkknkkknkkkkkkkkkkkkkkkkknnnkkknkknkkkkkkkkkkkkkknnnkkkknnktkkknkknnnknnkknkknkknkknkkknkknnkkkknnnnknnnknknkknknknnnknkkkknkkkknkkkkkknkkkkkkkkkkkknkkkkknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkknkkkkkkknknknnknkknknknbhhhhhhhhhhhhhheeepcuxirvhhhhheliknxtwcpppcawxinknknknnknknknbhhhhhhhhhhhhhhoeeeeeejp`unkkkkkknknknknknghhhe`wcpjjpattnnnnnkknknknknnknkknnkknkkknkkkkkkkknknkknkkknkkkkkkkinknknkknknnnknkknknkkkkkkkkkkknkknknnkknxpctkkkkkkknkknnknnkknnkknknknnnknnnnnkkkkknknkknknkknnkknknknnkkkkkkknknnknkknkkkkkkkknnknkknknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkknkkkknnkkkkkkkknknknnkkkkkiqhhhhhhhhhhhhhleejcwrrvhhhhheennnitwadppc`utxnnnkkknknnknnkrshhhhhhhhhhhhhhleeeeeejdwuxinkknnnnknnknnnnmohetuapjjd`xxnnknnknkknknknknnnkknknknknknnkknknnkknnknknkkkkknkkkknnnknkknnknnknnknkknkkknnknkkkkknnnknknknknnnkkkkkkknnnknnnnnknnnkknkknkknnnnnnnnnkknknnnknnkknknkknkknnkkknnnknknkknkkkkkkkkkkkknknkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkknknkkknnnknmhhhhhhhhhhhhhoeejdtrvhhhhhelnnnitwadppd`uxnnnknnnnknnnknkkrvhhhhhhhhhhhhhheeeeeeepcwxinnknrgvbrknnnnknncjlit`dppcwxnnnnknknnnknkknkknknknknnnnkkkknnnnkknnkkknkkknkkknkkkknnnnnnknknnnnknkkkkknknkkkkkkkkkkkknnkknnnnnnnknkkkkkknnnknnkkknknnknnkkkknknkkkknnknkkkknkknnnnninnkkkkknkkkknknknkknkknkknkkkknnnnknkkkknnkknnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkknghhhhhhhhhhhhhheeesrvhhhhoeeinnxtwadppcawtikkkkkkknkknnknknrhhhhhhhhhhhhhhoeeeeeejp`uxnnnnnrqhhwxknnknnkkkkixwapdauinnknknkkknknnniirnikkknkknnniirrggsgikknnnknnkknkkknirrrgsggnnknkknknkkkkkknkkkknkkkkkkknknknirrbsssbnnnnkkkknnnnniiiikkkkkkkkkkknnknnnkknknnnnnnirrrsssggrnnnkkknkkknknnknknnkknkknrrrbsgsgrnnnkkkknrsgrkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnkkknnknnhhhhhhhhhhhhhhlewrvhhhhhelinnitwadppdawtinkkkknkkknkknknknghhhhhhhhhhhhhhoeeeeeejd`tiinknrshhhetkkkkkkkkknnxwcdd`uiknknnnnniiirrrssvqsikkkkknkrrgvhhhhhhminknknknknnknrbmqhhhhhhmiknknknknnnknkkknnknkkkkkkkkirrsvhhhhhhqgkknnrrrgssgssvmsnknkkknkkkknnnkkkknknknirbsmqhhhhhhhfsrkkkknkkknknnnkknknnnrbmfhhhhhhhfsrnnknrghhhtkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkknnfhhhhhhhhhhhhhoprvhhhhheennnxtwaddpdawxiinkkkkkknknknkknnrmhhhhhhhhhhhhhheeeeeeejcwxinnkirqhhoekkkkkkkkkkknxuaccwxrrrrrrssssvvfhhhhhhlankkkkirgqhhhhhhhhhqxnnknknkknrbmhhhhhhhhhhhgknkknnkkknknnkkkknkkkkkknrrsqhhhhhhhhhhfnkrshhhhhhhhhhdakknkkknkkkknnnknkkknrrgvhhhhhhhhhhhhhhmnknknnknknknnnkknrbmhhhhhhhhhhhhqvsbrgqhhoekkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnknknghhhhhhhhhhhhhhrshhhhhelinnitwacppdawxinnnnkkkkkkkkkkknkkrfhhhhhhhhhhhhhheeeeeejpcuxinnirmhhhopkkkkkkkkkkknit`aaugvfhhhhhqhhhhhhhhhhhetnnknrrvhhhhhhhhhhhhhinnnknnnrsqhhhhhhhhhhhhhwknkknknknkknknknkknkkkirsqhhhhhhhhhhhhhdnrfhhhhhhhhhhlakkkknkkknkkkknnnnnirgfhhhhhhhhhhhhhhhhhfnnkkknknnknknknrsqhhhhhhhhhhhhhhhhhhhhhhodkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkrhhhhhhhhhhhhhhshhhhheeinnituadppdawtinkknwctkkkkkkxkkkknrhhhhhhhhhhhhhhoeeeeeejp`uinnnrghhhhlankni`dxkknknixw`wxshhhhhhhhhhhhhhhhhhljnnnnibqhhhhhhhhhhhhhqonntnnirshhhhhhhhhhhhhhhhwcxnknknknknkkkknkknkrbvhhhhhhhhhhhhhhqhurhhhhhhhhhhhexkknxcwkkkkkkkkkknrbmhhhhhhholeedqhhhhhhhqnnnnknknnnnnnrshhhhhhhholeeelhhhhhhhhhhlckkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnknnvhhhhhhhhhhhhhhhhhhlexnnixwacdpda`uxnnkkkukknkkkkiwknkkrghhhhhhhhhhhhhhleeeeeejdwxinnrrqhhhhexkniiiiwnkkknnxtutxghhhhhhhhhhhhhhhhhheanknrrqhhhhhhhhhhhhhhho`i`iirvhhhhhhhhhhhhhhhhhlpnknnwdpaknnknkknknrbqhhhhhhhhhoeeehhhhvshhhhhhhhhhoennknnkukkkkkkkknnrsqhhhhhhhlepuxnshhhhhhhhonknnknnknknrgqhhhhhhhledunkiwfhhhhhhhhlwnknnknkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnmhhhhhhhhhhhhhhhhhlecxiitu`ddpdawtxnnkkkkunkknkkk`kkkkkrvhhhhhhhhhhhhhheeeeeeejpwtnxrbqhhhhoeuinxttt`nnnkknnxxixrcllhhhhhhhhhhhhhhhetiurbqhhhhhhhhhhhhhhhhhjtxwrshhhhhhhhhhhhhhhhhhoaxinnnkuknknknxtxnrshhhhhhhhhheecxxumhhvvhhhhhhhhhhljtxiiinwknknnkttirshhhhhhhhledtnirmhhhhhhhhhpxnnitiutnnrqhhhhhhhoewnniituxvhhhhhhheuniixxinknknkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkknkkrhhhhhhhhhhhhhhhhlepwtttu`cpddawuxiinnkkktknkknnkwkkkk`rqhhhhhhhhhhhhhheeeeeeejduxrrsqhhhhhlpudtuw`wainnknknnninxwccashhhhhhhhhhhhoextrbqhhhhhhhhhhhhhhhhhhewurshhhhhhhhhhhhhhhhhhhodttxnnnunknknnuturshhhhhhhhhheedwxtuwfhqhhhhhhhhhhhedacxtttwinnkndubrvhhhhhhhhledw`crbqhhhhhhhhhld`xxaauuwrshhhhhhhhepuiitu`c``qhhhhhhexix`wuuinnininnkkknkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnkknkkkkkkniqhhhhhhhhhhhhhhlejd`wuwacdpdawtxinnnnknktknnkknkunnnxibhhhhhhhhhhhhhhoeeeepdcwtrrgfhhhhhhhl`iiaw`awainnnkkkknknknwnnrhhhhhhhhhhhhljubbqhhhoelvhhhhhhhhhhhhecrghhhhoeeqhhhhhhhhhhhhojawutxnuknknkna`rghhhhhhhhhoee``ju```shhhhhhhhhhhhoew`awwwuainnnunirvhhhhhhhhoedwwwprmhhhhhhhhhhopjtxwnnntrqhhhhhhhhetwuww`adccshhhhhoeutu``wttnkikkkkkknkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkknkknknknkkkkknshhhhhhhhhhhhhoeeedc``adppda`txinnnkkkkntkknnknnunknuishhhhhhhhhhhhhhsrbrrrsssmvhhhhhhhhhhetitaacc``innknknkkknnnukkrhhhhhhhhhhhhedgrfhhhlectbhhhhhhhhhhhoegbqhhheecitmhhhhhhhhhhhoepcautiwnkunkwirshhhhhhhhhhleaaadacpdshhhhhhhhhhhhlecddccawaxnnntirvhhhhhhhhhedc`aa`rhhhhhhhhhhhoep`u`xnntghhhhhhhhhex``ccdppddwfhhhhoea``ccawunniknkkkknknkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknkknkkghhhhhhhhhhhhhheeejpccddddawuxinnnnnnkkkukkknnknwnnnnrfhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoeitcccda``inknknknkkkkkunirhhhhhhhhhhhoecrvhhoeecxirhhhhhhhhhhhocrfhhheexnnbshhhhhhhhhhhlejjdauxwnkuknwrshhhhhhhhhhoejw`adpjlashhhhhhhhhhhhejjjejjd`axnnnrrvhhhhhhhhheexp`wa`shhhhhhhhhhhoepdaaxnnbshhhhhhhhhewdcpjjjjdcamhhhhoedddpdcwunkxkkkkkknkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkknknnkkkknkrqhhhhhhhhhhhhhleejjppppdcwtxnknkknkkkkkukkknknnwiknkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlpdjacdpjjpd`kknnnkkkkwcddgshhhhhhhhhhhlershhheedpxtbhhhhhhhhhhhorshhheeuinnrmhhhhhhhhhhhleeejdppddddnkrbqhhhhhhhhhhed`pjejjeewshhhhhhhhhhhheeeeejjejppdnnrvhhhhhhhhhoeutwpjlcshhhhhhhhhhhoejjpjdxtgvhhhhhhhhhljjejljjjpp`ghhhhlepjjejcawnxxknkknkkknkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkknnnkkknnmhhhhhhhhhhhhhoeeeejjjdc`txnnnnnnnnnkkkwunkkkknk`nnrghhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhewuwcdpdauxnnnnkknknnkkkkkimhhhhhhhhhhhegbhhheedwtirshhhhhhhhhhhsghhoeeauxxwrfhhhhhhhhhhheeeejpcwxnnnnirqhhhhhhhhhhlewadjjjeljsvhhhhhhhhhhhleeeeeejdatikkrshhhhhhhhhhepu`adpjpshhhhhhhhhhheeejpc`tirvhhhhhhhhhhjjjeejdawttrfhhhljjjejpdwxnkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkknkkknkkkkghhhhhhhhhhhhhheeeejjpcwuxinknkknknkkkkxuinkknknnnkrmhhhhhhhhhhhhhhlelllloohhhhhhhhhhhhoewwcpjjdatxnkkkkknkkknknkkrvhhhhhhhhhhodrfhheejcwtxrmhhhhhhhhhhhrqhhlejawxtubhhhhhhhhhhhheeeeejd`tnkknrvhhhhhhhhhhoeccdjeeejjpbvhhhhhhhhhhhleeeeeejc`tinrbhhhhhhhhhhoeu`cpjjljahhhhhhhhhhoeeeeepawxivhhhhhhhhhhoeeejpawtxiimhhhejjeeepcwxnkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknkknkkkrqhhhhhhhhhhhhhleeejjc`uxnnnknnnnkkkknnnknnkkkknknnrfhhhhhhhhhhhhhheeeeeeeelllhhhhhhhhhol`cpjjjd`tiknnnkkknknknkknrhhhhhhhhhhhorshhlelpauxxrfhhhhhhhhhhmmhhleepcwtxrmhhhhhhhhhhhoeeeeejd`txnnrshhhhhhhhhhhejcpjjeeejpcrqhhhhhhhhhhheeeeeejjcwxnirqhhhhhhhhhhep`cpjeejpdvhhhhhhhhheeeeejjcwtrvhhhhhhhhhhqeeejd`tinnnshhheadjejpcuxnkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkknkknkkkkkrvhhhhhhhhhhhhhoeeejpauxinnnnkkkknkkkknnnnknkknnnknrhhhhhhhhhhhhhhoeeeeeeepc`uaqhhhhhhhljdpjljjcwxnnkknknkkkkkknnnshhhhhhhhhhhbghhoeejd`uxtbhhhhhhhhhhhshhoeeepcwutrfhhhhhhhhhhhleeeeejpatxnnbqhhhhhhhhhhoedpjeeeejpcurhhhhhhhhhhhoeeeeeeedauinrmhhhhhhhhhhoecdpjejejd`ufhhhhhhhleeeeeejd`tifhhhhhhhhhhhheejcwtinkkkhhoe`cjjepauinkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknnknknibqhhhhhhhhhhhhhheeejc`tinkkkkkkkkkkknnknknnnnkkknnishhhhhhhhhhhhhhleeeeeeejdawwuvhhhhhhejpeeelpcwxnnknkkknknknknkrmhhhhhhhhhhqrhhheeepcwutrshhhhhhhhhhfqhheeejpawugbhhhhhhhhhhhheeeeeejd`uinrmhhhhhhhhhhhlepjeeeejjd`bshhhhhhhhhhhleeeeeejdwtirbhhhhhhhhhhhlecjjeeejpawxicooooleeeeeeeejd`tishhhhhhhhhhhhpejdwxnnnnkneejwapjjd`tinkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkknknnknkkkkknkkirvhhhhhhhhhhhhhhhleejdwxnnkknkknnkknnnnkknnknknkkkkrvhhhhhhhhhhhhhheeeeeeeejpdaaashhhhhoeeeeeejpauinknknkkknkkkkknrfhhhhhhhhhhmmhhleejdauturvhhhhhhhhhhqhhoeeeepd``tshhhhhhhhhhhheeeeeejp`tirghhhhhhhhhhhoejjeeeeejdauxmhhhhhhhhhhheeeeeeepcwxnrfhhhhhhhhhhhepjleeejpcwxnkkncppleeeeeeeejdwtibhhhhhhhhhhhhhjjd`xnkkkkknnit`dpjd`tnnkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkrrvhhhhhhhhhhhhhhhhleejd`tnnkkknnknnkkknnkknnnnnnkkkkrqhhhhhhhhhhhhhoeeeeeeejjpdddc`vhhhhleeeeeejd`tnnnkkkknkknknkknrhhhhhhhhhhhshhoeeejdawwwrhhhhhhhhhhhhhoeeeejpda`rfhhhhhhhhhhhleeeeeejdwtirfhhhhhhhhhhhlejeeeeejpawxrvhhhhhhhhhhoeeeeeeepauxrghhhhhhhhhhhlejjeeeejd`uxinnnntwcpeeeeeeejdwxnrhhhhhhhhhhhhhhjp`unnknkknknxucppcwtnnkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkknknkkkkirvhhhhhhhhhhhhhhhhhheejp`uinknkknnknnnkknkkknknknnnknbhhhhhhhhhhhhhhoeeeeeeejpdcccc`mhhhhleeeeeepcwtiknknknnkkknkknnshhhhhhhhhhffhheeeepdaw`gghhhhhhhhhhhhhleeeejjdcwbhhhhhhhhhhhhleeeeeepcwxrghhhhhhhhhhhoeleeeeeepc`xxrhhhhhhhhhhhleeeeeejd`tirfhhhhhhhhhhhlejeeeeepcwtinnkinxwcpjeeeeejpawxnnmhhhhhhhhhhhhhhjcwxnkknkknniu`ddcuxnkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknkknkkknrvhhhhhhhhhhhhhhhhhhheeepcuinnnkkntknnnknnkkknnknnkknimhhhhhhhhhhhhhhleeeeeeeejcwwwaushhhoeeeeeejepwxnnnknknknnknkkkrvhhhhhhhhhhqhhleeeepca``bmhhhhhhhhhhhhoeeeeejppdbmhhhhhhhhhhhoeeeeeeejawxrfhhhhhhhhhhhleeeeeeejpauxrghhhhhhhhhhheeeeeeejdwtrghhhhhhhhhhhhejeeeeejdauinnknnixuadjeeeejjd`uinkrhhhhhhhhhhhhhhqd`uinkkkkkkitwac`uinnkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnknnrshhhhhdfhhhhhhhhhhhhhoeejc`xnnknkainnnnnkkikkkknkknkurvhhhhhhhhhhhhhheeeeeeejdawuttwbshhhoeejeeejdcuxnkknknknkkkknknrqhhhhhhhhhhhhheeeejpcaawrqhhhhhhhhhhhhleeeeeljjarqhhhhhhhhhhhoeeeeeejpaurghhhhhhhhhhhheeeeeeeepcwxirmhhhhhhhhhhheeeeeeepcuxrmhhhhhhhhhhhleeeeeeepdwxinnnkknitwcdjjjjpd`uxinnnmhhhhhhhhhhhhhhqcwxnnnnknnnxu``wtikkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkknrshhhhhljmhhhhhhhhhhhhhoeejdatinknkanknnnuunkkxxknuini`rhhhhhhhhhhhhhhoeeeeeejed`tiiwwishhhljjjeeejdcxinnnkkkkkiuxukuighhhhhhhhhhhhhoeeeeejcaagghhhhhhhhhhhhoeeeeeejjjwghhhhhhhhhhhheeeeeeejd`trfhhhhhhhhhhhoeeeeeeejpauxnrqhhhhhhhhhhleeeeeejd`uirhhhhhhhhhhhhleeeeeejpawxnkknkknnxuwccdddcautinkkkrqhhhhhhhhhhhhhhpauxnknkkknixuutxnnkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknknknrshhhhhletrhhhhhhhhhhhhhheeepcuxnkkxxknnkwutwkntwnnutnnsghhhhhhhhhhhhhhoeeeeeeejd`xinuanshhhedppjejpccxnnnnnnnknna`waubmhhhhhhhhhhhhheeeeejepcabmhhhhhhhhhhhhleeeeeejjdbmhhhhhhhhhhhheeeeeeejcwrbhhhhhhhhhhhheeeeeeeejcwtinghhhhhhhhhhhleeeeeejdwtrshhhhhhhhhhhheeeeeeejcatinnkknknnnitu``a`wuxinkkkknghhhhhhhhhhhhhhqp`tinknkkknnxxinnkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkknkkrshhhhhleukrqhhhhhhhhhhhhhleejc`tnnkukkknn`da`kknunknuknrmhhhhhhhhhhhhhhleeeeeejpwxinnntishhheuccjjjpacinknwdddd`ktukukrvhhhhhhhhhhhhleeeeeejec`rqhhhhhhhhhhhoeeeeeeelparqhhhhhhhhhhhleeeeeejpawrmhhhhhhhhhhhheeeeeeejpauiirmhhhhhhhhhhheeeeeeejcwxrvhhhhhhhhhhhoeeeeeejpautinknknkknnnnxtttutxinnkkkkkkfhhhhhhhhhhhhhhhd`tnnnknknnnnnnkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknrbqhhhhleuknnmhhhhhhhhhhhhhheejpauinkuknkkutnnwnknunkkunkrfhhhhhhhhhhhhhheeeeeejjpwxnnnkunmhhlexcapjjd``inkknnnknknutkunrhhhhhhhhhhhhhleeeeejjjcughhhhhhhhhhhhleeeeeeejpgghhhhhhhhhhhhleeeeeejd`trqhhhhhhhhhhhleeeeeeejc`tinrqhhhhhhhhhhoeeeeeejpauirhhhhhhhhhhhhoeeeeeejp`tninnkknknkknnnnxiiinnnnknnknknqhhhhhhhhhhhhhhjawtnknkkkknknkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkknknknkkkkkkknkkkkibqhhhhoe`knnxghhhhhhhhhhhhhheeepcwxiniuknk`kkiaknn`nnuuknrhhhhhhhhhhhhhhoeeeeeejdduinnknukgqhlan``dppcw`irikknnnnnnuuktnshhhhhhhhhhhhoeeeeeejjdabshhhhhhhhhhhheeeeeeeejdbmhhhhhhhhhhhoeeeeeeejc`bghhhhhhhhhhhheeeeeeejpcuxnighhhhhhhhhhhleeeeeejd`uighhhhhhhhhhhhleeeeeejc`tnkknknkknkknkkknnnnnnnnnknknkkrqhhhhhhhhhhhhhhjautnknkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknrbqhhhhoedniniusfhhhhhhhhhhhhhleepc`tinnakkkidcuwwnnicdxdtishhhhhhhhhhhhhhleeeeeeejjpankucddcadejppjjddjpdbsqmnkkknnxd`kdrmhhhhhhhhhhhhleeeeeeeec`rfhhhhhhhhhhhlleeeeeejd`rqhhhhhhhhhhhoeeeeeeepaurshhhhhhhhhhhheeeeeeejd`tinrmhhhhhhhhhhheeeeeeejc`trshhhhhhhhhhhheeeeeeepcuinnkknkknknnnkkknnknknknnknkkkknshhhhhhhhhhhhhhod`uxnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkknkibqhhhhoednnixu`amhhhhhhhhhhhhhoeejd`uinnxxnkknknkkkknknknkrvhhhhhhhhhhhhhheeeeeeejcwxnnkkkkkknkknntwcdc`tibqhhcnkkkkknnnkrqhhhhhhhhhhhheeeeeeejpctbhhhhhhhhhhhheeeeeeeepdgghhhhhhhhhhhheeeeeeejdaurfhhhhhhhhhhhoeeeeeeepawxnnbhhhhhhhhhhhoeeeeeejpauirvhhhhhhhhhhhheeeeeejdatinnikknkkkkknknkkkkkknknnkknknknnmhhhhhhhhhhhhhhlc`tinknkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkirvhhhhhedkniiuwcdshhhhhhhhhhhhhheeepauxinnknkkkkknnkknknknnrqhhhhhhhhhhhhhheeeeeejpauxnnnknknkkknnnxwcdawxrvhhoeikkknknknnbhhhhhhhhhhhhleeeeeeejdabshhhhhhhhhhhoeeeeeeejparmhhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhhleeeeeejp`uinrshhhhhhhhhhhleeeeeejd`uirvhhhhhhhhhhhheeeeeejdwtiknnnkkkknnknknkkkkkkkkknnnnkkkknnvhhhhhhhhhhhhhljcwtinkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkirvhhhhoejknnxuwcdp`fhhhhhhhhhhhhhleepcwtinnnnnknnkkkkkkknkknghhhhhhhhhhhhhhoeeeeeejd`tinknkkkkkkkknitwacaurshhhlpnknnnknknimhhhhhhhhhhhheeeeeeeepcwrfhhhhhhhhhhhleeeeeejjdwrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhheeeeeeejcwxinrqhhhhhhhhhhheeeeeeejdwtnrhhhhhhhhhhhhoeeeeeejcwxnknkknkkkknnnkkkkkkkknkknknnnnkknnifhhhhhhhhhhhhhedauinnkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkrrvhhhhheliknit`adpdcshhhhhhhhhhhhhoeejdwtinnknknknknknknknnnishhhhhhhhhhhhhhleeeeeejdwtnnkkknnkkknknnxw`a`rbqhhhlwnnknnknnnrvhhhhhhhhhhhheeeeeeejdatbhhhhhhhhhhhoeeeeeeljpatbhhhhhhhhhhhheeeeeeeedatishhhhhhhhhhhoeeeeeejpawiirmhhhhhhhhhhhheeeeeeepcwxnrhhhhhhhhhhhhoeeeeejpawxnknnnknkkkkkkkkkknkkkrsrkknknnknknnbqhhhhhhhhhhhhejd`tinkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknnrvhhhhheennnixuadpdcabhhhhhhhhhhhhhheejdatinnnnknkknknknnnkknrfhhhhhhhhhhhhhheeeeeeepawinnkknknkknnnnnxtw`brfhhhoexknnninnnnrhhhhhhhhhhhhleeeeeeejcwrshhhhhhhhhhhoeeeeeelpcwbshhhhhhhhhhhheeeeedejdwtrmhhhhhhhhhhhoeeeeeejd`uiirqhhhhhhhhhhhoeeeeeejp`txnrhhhhhhhhhhhhoeeeeejd`tnikknkknnrnkkkknknkkknbhhmnkknnknkknishhhhhhhhhhhhljjcwxnnkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknrmhhhhhllnnnituacpdc`urhhhhhhhhhhhhhhleepcwxnkknnnnkknknkknnnnrhhhhhhhhhhhhhhoeeeeeejpatinkknnkkknkkknnnxtxrvhhhholnknnixxinishhhhhhhhhhhheeeeeeejpaurvhhhhhhhhhhheeeeeeljpaurvhhhhhhhhhhhleeeejrsaawxrvhhhhhhhhhhhleeeeeejc`tnrshhhhhhhhhhhhleeeeedddwtnnrhhhhhhhhhhhhoeeeeejdwxxnnkknnnrghgkkkkknnkkkshhhcnkknnnnknnimhhhhhhhhhhhoejpawinkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnrshhhhhleunnixwacppc`uxrmhhhhhhhhhhhhhleejd`tinkknknknnnnknknnishhhhhhhhhhhhhhoeeeeeejd`xinkkkknkknnknnnnnrrvhhhhheannnxxtxinrmhhhhhhhhhhhoeeeeeeejc`xrhhhhhhhhhhhheeeeeeljc`trqhhhhhhhhhhheeeeebghhctirvhhhhhhhhhhhleeeeeepauxibqhhhhhhhhhhhheeeeelrsswinkrhhhhhhhhhhhhoeeeeejcwxnnkkknkrbqhhfkkknkkkknshhhenkkkknkkknirqhhhhhhhhhhoeejd`tnnkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkrshhhhhleunnituacpdd`wxnnshhhhhhhhhhhhhheejpauxnnnkkknknnnnkknkimhhhhhhhhhhhhhhleeeeeejcwxnnkknnnkknnknknnirvhhhhhhexnnxuwwuxirfhhhhhhhhhhhleeeeeejjawrshhhhhhhhhhhleeeeeelpawrbhhhhhhhhhhhheeeearqhhl`iivhhhhhhhhhhhleeeeejp`wrrmhhfhhhhhhhhhheeeeegbhhfikkiqhhhhhhhhhhhheeeeejcuxnknkkkirfhhhldkknkkkkimhhhlnnnnkknnnknishhhhhhhhhhoeejpauxnkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhletnnixwaddpc`wxiknrhhhhhhhhhhhhhheeejcwxnnknknknnnnnnknnrfhhhhhhhhhhhhhheeeeeejpaunnnnnnknkkkknkkkrrvhhhhhhoennxtwaawxibhhhhhhhhhhhheeeeeeejdaurvhhhhhhhhhhheeeeeeejpaurshhhhhhhhhhhoeeejrmhhoeunivhhhhhhhhhhhleeeeejd`trshhmhhhhhhhhhhoeeee`rqhhlcnnnvhhhhhhhhhhhheeeeepawxknnkkirvhhhoe`kkknkkkrvhhhounknnnkknnnnrqhhhhhhhhhoeeejdwxnkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhoeannixw`cppdauxinkkifhhhhhhhhhhhhhoeejd`txnnnnkknknknknknbhhhhhhhhhhhhhhoeeeeeeedaunnnkknkkkwcxnnirbqhhhhhhhldnitwacawtrghhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhheeeeeeejcwtrmhhhhhhhhhhhleeegghhhedinivhhhhhhhhhhhleeeeejcwrbqhhshhhhhhhhhhleeecrvhhoe`kknmhhhhhhhhhhhhoeeejpauinkkknrshhhhepnnkknnnkrfhhhhdniiiinnnknnnshhhhhhhhhleeejpatikkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkknkkkkkkkkkkkkkkkkkkinrshhhhhhejknixu`cpdcawtinknknfhhhhhhhhhhhhhheejpauxnnkknnknknnnknimhhhhhhhhhhhhhhleeeeeejd`tinknnknknkntnrrshhhhhhhhheuitucpdauxrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhoeeeeeelpcwxrvhhhhhhhhhhheeebbqhhleunnnmhhhhhhhhhhhheeeeeparbqhhvmhhhhhhhhhhleepbshhhepnnkkghhhhhhhhhhhhheeeepauxnkkirshhhhlenknnnknnnrhhhhhjixttxinknknnghhhhhhhhheeeeepawxnkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkknkkkkknnnkknrrghhhhhhoeitxxu`ddpdawwuxkkktrshhhhhhhhhhhhhhoeepcwxinkkntxuntinknrfhhhhhhhhhhhhhhleeeeeepcwxnnittnknnnnrrgfhhhhhhhhhoewwuapjjdairhhhhhhhhhhhhleeeeeejd`trmhhhhhhhhhhhleeeeeejdauxrfhhhhhhhhhhheebbqhhoeaxnnkshhhhhhhhhhhhqeeej`rbqhhorvhhhhhhhhhhleprshhhletnknkiqhhhhhhhhhhhhqeejp`tinnirvhhhhleukkniniiinrhhhhhhutuuuxinnnknrhhhhhhhhheeeeejcwxnkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkknnnxkkktnixikirvhhhhhhhopawtu`cppdcwuwuwxnktxshhhhhhhhhhhhhhhjejd`tinnkn`uw`t`nkrghhhhhhhhhhhhhhhleeeeejpcuxikutuwnknirgfhhhhhhhhhhhlj`p`djjpcwrghhhhhhhhhhhheeeeeeejcwxrqhhhhhhhhhhheeeeeeejdwtirhhhhhhhhhhhhvrbqhhoejtnnnirhhhhhhhhhhhhhvmwrrmqhhoerhhhhhhhhhhhfsrshhhleannnnnimhhhhhhhhhhhhhfcppatiirbfhhhhoewnnnixtutxighhhhhhjw`awtnnnnnnrhhhhhhhhleeeeejd`tikkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkknnkkkkininitrbvhhhhhhhhhdxwuwcppdcwtx`cutnnnrshhhhhhhhhhhhhhhqplddpcccwkxtkuntnirfhhhhhhhhhhhhhhhleeeeeejjdtnkwawtirrsfhhhhhhhhhhhhhed`adpjjcwxrmhhhhhhhhhhhoeeeeeejpauighhhhhhhhhhhoeeeeeejpcuxirhhhhhhhhhhhhhvhhhhleaxiknxtvhhhhhhhhhhhhhhvvhhhhheprhhhhhhhhhhhhvfhhhoepxiknnxxxqhhhhhhhhhhhhhqsgrrbsfhhhhhoednnkixww`uxrshhhhhhqaacauinnknighhhhhhhoeeeeeejd`xinkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkknnkkxnnirrgqhhhhhhhhhhmt``cdppc`uxwikntknirfhhhhhhhhhhhhhhhhqscawxnkkkxtktnxrrvhhhhhhhhhhhhhhhhqcpeeejc`xiitrrrbsvhhhhhhhhhhhhhhhoewcjjjjjawxrfhhhhhhhhhhhleeeeeejc`trmhhhhhhhhhhhleeeeeejdatinrhhhhhhhhhhhhhhhhhledwxinxtwshhhhhhhhhhhhhhhhhhhhelirhhhhhhhhhhhhhhhhoejuxinixtuushhhhhhhhhhhhhhhhhhhhhhhhhoecnknitu`aawtrshhhhhhhqddcwxnknnrfhhhhhhhleeeeeejd`tnnkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkknkkxrrgvhhhhhhhhhhhhhfgbuppc`uxiunirrrbsfhhhhhhhhhhhhhhhhhhhfsbrinknxxirrbsqhhhhhhhhhhhhhhhhhhqmsrrrrrrgsgmvqhhhhhhhhhhhhhhhhhhoe`djejejatxbhhhhhhhhhhhheeeeeeejcwtrfhhhhhhhhhhheeeeeeejcwxnnifhhhhhhhhhhhhhhhlejauxiiuw`wqhhhhhhhhhhhhhhhhhhlexkifhhhhhhhhhhhhhhheeauxxixww`wumhhhhhhhhhhhhhhhhhhhhhhhoedkkiixu`cca`trvhhhhhhhhmcd`tnnnrshhhhhhhleeeeeeejd`xnkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkknkkkkniinkkkngqhhhhhhhhhhhhhhhhhhqhpauxnktarvqhhhhhhhhhhhhhhhhhhhhhhhhhhhfskiaurvhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejejeejjdddgshhhhhhhhhhhoeeeeeejpaurbhhhhhhhhhhhoeeeeeeepcuinknmhhhhhhhhhhhhhhleed`uxitu`awgqhhhhhhhhhhhhhhhhlewnnkmhhhhhhhhhhhhhheep`txxxuwa`wtimhhhhhhhhhhhhhhhhhhhhhlednnkxxu`cccauxrvhhhhhhhhhfgubrrbmhhhhhhhlejjeeeeejdwtnkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkknghhhhhhhhhhhhhhhhhhhhhj`tinkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhowkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejjeeejjcuxrvhhhhhhhhhhhleeeeeejd`tishhhhhhhhhhhleeeeeejd`uxnnknhhhhhhhhhhhhhleejd`uttw`aawxshhhhhhhhhhhhhhheeaxnniiqhhhhhhhhhhhoeeedautttwaawuxinahhhhhhhhhhhhhhhhhhoeeunnnixuwaccawtirqhhhhhhhhhhhhvvfhhhhhhhhlepdjeeeeepcuxnnkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkrhhhhhhhhhhhhhhhhhhhhhewxnkkkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodnkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoejjeeejpauxnhhhhhhhhhhhheeeeeeejcwxivhhhhhhhhhhheeeeeeejd`tnnknkrhhhhhhhhhhleeeejdawuw`aawuxiwhhhhhhhhhhhhoeecwttxtuwhhhhhhhhhhleeejpawuw`aa`wtnnnn`ohhhhhhhhhhhhhholejxnnnxtu`cddawuxnrhhhhlllohhhhhhhhhhhhhhlee`wcjeeeejdauinkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkteeeeeeeeeeeeeeeeeeeeewxnnkkknkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeepnnnkkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeejd`tinneeeeeeeeeeeeeeeeeepauxnkdeeeeeeeeeeeeeeeeepcuxnnknknnoohhhooleeeeeeepcaaaaa`uxnnnxoohhhhhholeeejda`www`adohhhhhhoeeeeeepdaa`acawtxnnnnitplohhhhhhhhoolee`tttttu``ccdc`txinihhhel``dllohhhhhhhholeeaixwdjeeeejcwxikkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkknnnixuwadpeeeeejdwtinnnkkkkkknknnniixwapeeeeeeeeeeeeepc`txinnnnknknnkniiuwcpleeeeeeeeeeelpawxinnnnnnnnixxxxuuw`adpjjeeeeeeepcwtnknknnnniuadleeeeeeejp`tinkkknknixwdjeeeeeeejd`uinnkkknkn`peeeeeeeeeeeejpddccawtiiknniclllleeeeeeeejpccccccccpllleeeeeeeeejpdccca`uiiknknnxwajeelllleeeeepc`wwww`acddda`utnnnnglejxnxwdjeeelllleeed`knit`djeejjdauxnnkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkknknnixuwadjjeeeeejdawtxinnnkknkknnnixtu`cpleeeeeeeeeeeejpc`uuxiinnnknnnixuwapjeeeeeeeeeeeeejc`utxiniixxxxtuuw`acdppjeeeeeeeejpatxikknkkkniuapjeeeeeeejdwtnnkkkkknit`djeeeeeeejd`tnnknnknknniuapeeeeeeeeejjjdcawtinnknnixwcleeeeeeeeeejjpppdcawuucpjeeeeeeeeejjpdc`uxinkkkknitwcpjeeeeeeeeejppdcccddppdc`uxinkkkiuuxnit`djeeljjdc`iinnnnxwcpjeejpawxnnkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkknitw`cpjjeeeeeejjda`wtxnnkkknknixtuw`cpjeeeeeeeeeeeeeejpca`wutinnknnitw`cdjjeeeeeeeeeeeeejpcawwuuuuuwww``acddpjjjeeeeeeeeejd`tinnknkknnxucpeeeeeeejpcwinnkkknkiiuadjeeeeeejjawxnnkkknknknitadjeeeeeeeeejpdcwtinnknkkniu`djeeeeeeeeeeljjpdawttxuadjeeeeeeeejjpc`utinnknkkknitwcpjeeeeeeeeeejjjjjpjpdc`tixnknnnknkkkxtadjjeejpd`wuxxxxxw`djjjjpcwtinkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkknkixuacdjjjejeejejjddaawtinnkkknnxtw`acdpjejeeeeeeeejejjjjpdaa`utinnnitwacdpjjeeeeeeeeeejejjjddcaa`a`aaacccddppjjejejeeeeejjpcwxnknkknnknxwcpjeeeejejd`tinkkkkknnxuapjjeeeejjdauinknkknkkknixwcpeeeeeeeejjpa`txnknknknnnxwadjleeeeeeeejjpdawtiiitwcpeeeeeeeejpcauxinknknknknnxtwcdjjeeeeeeeeejjjjjpcawuxikikknknknnnitapjjjjjppcawuuuuwacpjjjda`txnnknkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkknntw`cdpppjjpjpjppddca`uxnnkkknixu`acddpppjppjpppjpjjjpppddcaawtxnnnxu`acdpppppppppjppjjpjppddccaccacccccddddppppppjppppjpdc`txnkkknkknnxwacpppppppdcwxinkkkknknxuacpppppppdawxinknnkknkknnxuacpjejejjjpcautinknkkknknnxxwadpjeeeejejjpd`wxinnniu`cpjeeeejjpc`utnnknkkkkkknnnxtwacppejeejejeejjpdcawuinnkkknknknkknxu`dppppddddcca```ccdpppcawxxnkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkknnxu`aaaccacccacacaaa`wtinkknkknitw`aaaacaacccccacccaccacaca``wtinnnitw`aaaaacacacaccccccacaaaa````a`aaaaaaaacccacaccdcacaawuxnnkknkknknxuwaaccccaa`wuinknkkkknnitwaaccccacawtinknknknnkknnnxu`cdpppddcawuxinnkkkkkkknnnitw`ddppjjppdda`uxikkknnxu`ddppppdcawuxnnknknnkknkknnnitu`acdppjjjjpppdc`wuxinnknkknkkkkknnit`cccaaaaaccccccacdcccawuxinkkkkkknkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkknixtuuuuuwuuuwuuuuuuttxixkkkknnixttuuuuuwuuuuwuwuuuwuwuwuuuuttxnnnnxattuuuwuuuuudauuutuuwu`uuuuuuwuuuac`cuwuawuuuwuwawwuutxxnnnkkkkknnnnxcwuuuuuuuttinnkkkkkkknnactuuuuu`ctxxii`iwikknkkknnixuw`aaa``wutxinkkkkkkkutkkknixuwaaccccaawutxnw`ikkkixu`acdccawuxinnnkkkkknknki`kknnxxuwaadccccca``wuxinnnkkkkkkknnknkkitu``wuuuuww```aaaaaa`wutxiknkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkknnixxxxxxxxiiiiiiixinnwnkkkkknnnniiiiiixixixxixixiixxxxxxxxiinnknnntiiixxxixxxxpxxixxiii`txxxxiuwixiucupixiiwixixixwiixxiinkkkkkkkkkknnniuxxiiiiuiinnkkkkkknkknntiixiiuxiatnnkdndxkknknkknnnxxtuuuuxxxinnnkknkkkkkxknkkknuxuuwwwwuuxxinnknxkkknnixuuwwuutxnnkkkkkknknkkkkxnknknnittuwawwwuuutxinnnkkkkkkkkkkkkkknnixuttxiixxttuuwwwuuuttxinnkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknnknnnnnkninnnknnnnnkwkknknxinkntnxxinnxxnxtknnnnttnnnxxxtiknkkixnxnnnnnnnnnnuunnnnknnnwnnnnnnunnnnt`icnnnnunnknknitnnnknkknkkkiinxxknnnxxtnnniwxxxnkxixninnkkkxnnknkxnnnnknkck`nknkkknkknknnniiiiinnnkknkkknkkkkinxnkniwtuwtxututitnnkkkxnkkkknnixiutuxixknkkixnkkknxxnxkknnxxnniix`xxxxiinnnnkkkkkkkkkkkknkkkkkniininnnnnniixxxxxxiinnknkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkknkknknkkkkkkkkiikkkkxxxtkkxwuxttknu`xx`kkxuxxwnkiwtxtiknxtxuwkkkkknkkknunkkkknkkiiknnnnntknkknukukkkkktkkkkkntkkkkkkkkkkkiuwxxwkkk`xxukknuxxnkkxwxwxtiknkxkkkkkiwinkkkk`kukknkkkkkkkknknnnnnknknkkkkkkkknkkutxtnknutttnntwtwxxtkkkkikkkkkknnnnx`xwxxxkkutxuxnkitxuwkkxuxiwnnnnxxnnnnnnnkkkkkkkkkkkkkkknkknknnnnknkkknknnnnnnnnnnnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkxkkkkktwutkkktkkktkktkkknxnuixxtukkikkkxkkxkkktnnknkkknkkkkknkknkkxkkkkkkkxkkkkkkkknknkktnkkkkkntkkkkkkkkkkktkkknxnkxkkxkkkxkkkkkkukxkkxkkkxkkkkkkkktikkkknkkkkknknkkkkknkkkkknkknknknknkkkkkikkkxkkxkknnnk`ktkkxkknkxkknkwuwwwikwkxkkiknnkkkxkktkkktkkuiixtukkkkxkkkkkkkkkkkkkkkknkknkkkknkkkknknkkkkknknkkknknknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkxkkkkxnkkxkkktkkkxnktkkknikwiixiinkxkkkxkkxkkkikkkkknkkkkkkkkkkkknikkknknkxknkkknkknkknknukkkkkkwkkkkkkkknkktkkknikkxkkxkkkxknkkkkwkikkxkkkxkkkkkikknxkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkxkknxkkxknkkknwkxkkxnkknxkkkkkkkkknkwkikkikxkkkkxkkxkkkxknuxiixnkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknikkkxkknukkkwnknxkkutknukkttkkknkkxnnkxkktnkiwkknkkkkkkkkkkkkkkkknxkkknkntkkkkkknkkkknkktkkkkkknnkkkkiukkkkttkntkkkxkkikkktkkknkkukxkkxkkkxkkkkkttxxkkkknknkkknkkkkknknkkkkkkknwiknkknkkkkkkxkkkxkkinknnkkwkikkinkkkxnknkkkkkkkkukikkikktnknxkktnkiwkktxkkknknktkkkkkkknknkkkkkkkkkkkkkknknkkkkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkktkkknuuixtkkituxkkkinutnkkkiuwiknxuikxukkktuxnwkkknknknkkkknkkkkkkukknkkktnkkkkkknkkkkkkntkkkkkkukkkkiukkkkinutnkkuuknuukkkuwuikuukxnkukxuuwuikkkkiknkkknkkkkkknkknkkkkkkkkkkknunkknkkkkkknxunkuuikkxwuxktuinxkxinwuuutkkkkkkkktuinxkxnkkuuxkkkkuuxnukknuuiknkkukkkkkkkkkkkkkkkkkkkknkkknkkkkknknkkkkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkknnkkkkkkkkkkikkkkkkikkkkknkkkknkkkkkknkkkkkkkknkkkkkkkkkkkkknkkkkkniknknkkxkkkkkkkknknkkknnkkkkkikkkkkkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkxnkkkkkkkkkkknkkkkkkkkkkkkkknknkknkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkuwtkkkkxwuknkkknkkkkknkkkkkkkkkkkkkkknkkknkknkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkxwunkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknknkknkkkkkkkknkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknnkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknktixikkkxkkkkkkinkkkkkkkkkkkkkkkkkkknxkkkkkkkkkkkkkkkkkkkkknxnkkkkkkikkkkkixnxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkktikkkkkkkkkkkkkkkkkkkkktxkkkkknkkkkkkkkkkkkkkkkkkkkkkkkinkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkxnkkkxixtkkkknkkkkkkikkkkkkkkkkkkkkkkkkkknkkkkkkknkkkkkkkkkkkkkkknkkkkkikkukkkntnukkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkikkkkxnixkkkkikkkkkkiknkkkkkkkkkkkknnnkkknknkkkkninnkkknnnknkkkkknkkkkknkkkkkknxktkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkinikkkninnnkkininnnkkkknkkkkkkkkkkkiniknnkkkknikkkkknnknkkkknkkkkkkikkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnkkknnnnnkkkkknkkkkkkikkkkkkkkkkknxnninkkninnnkkninnkkkinninikkkknkkkkkninkkkkkikikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkxnnikkninnnkknxnxninkkknkkkkkkkkkkknxnxnnnkkxnnxnkkinnxnkkinniikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkikkkkkkikkkkkkkkkkknnnnnxkknkkknkkknkkkkknnknknkkkknkkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkxknkknkkknkkkkkxxxxxkkxknkknknkkkknknkkkknkkinnnikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkikkkkkkkkkkinnnnnkkkkkknkkknkkkkknnknknkkkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknkkkknknkkkknkkinnnnkkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkknkkkkkiikkkkikkkkkknkkknkkknkkkkknkkkkkkkkknkkkknninkkkkkkkkkkkkkkkkkkkkkkkkkkkkikkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknnkknkkknkknnkkxkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkknkkkknnkkkkkiinkkknnknnnkkkinnkkinkikknkninnikkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknikkkkkkkkkkkiikkiikkkninkkiiknnkiknninikkkkkkkkkinknkkikkkiinkkkkinnnnkkniikkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk"
};